PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g10075.3.p
Common NameBRADI_3g10075, LOC104583495
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 346aa    MW: 38648.5 Da    PI: 9.6279
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g10075.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.81.9e-1659105148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       r rW++eE + l++ v+ lG+++W+tIa  m+  R+++qc++rw  yl
  Bradi3g10075.3.p  59 RRRWSEEENDVLIQMVQNLGTKNWSTIACAMP-LRSRYQCRERWTYYL 105
                       78******************************.9**********9886 PP

2Myb_DNA-binding48.32.3e-15111155147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       r++W+++++  l++a++++G++ W+  a+ ++ gRt+k +k++w+ +
  Bradi3g10075.3.p 111 RQAWSEQDEVTLIHAHEMHGNK-WRELAKLFP-GRTGKAVKNHWNGH 155
                       89********************.*********.***********966 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.26454105IPR017930Myb domain
SuperFamilySSF466891.91E-2657152IPR009057Homeodomain-like
SMARTSM007171.5E-1258107IPR001005SANT/Myb domain
PfamPF002498.8E-1459105IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-1961112IPR009057Homeodomain-like
CDDcd001671.17E-1161105No hitNo description
PROSITE profilePS5129424.579106160IPR017930Myb domain
SMARTSM007176.2E-14110158IPR001005SANT/Myb domain
PfamPF002493.1E-14111153IPR001005SANT/Myb domain
CDDcd001672.62E-10113153No hitNo description
Gene3DG3DSA:1.10.10.601.4E-20113161IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MRQTEDGLPM RRSTSRSSQM RGIAQERAKL QDAPSKNAKW RTVAECIHRK TGVYSFKKRR  60
RWSEEENDVL IQMVQNLGTK NWSTIACAMP LRSRYQCRER WTYYLNPALN RQAWSEQDEV  120
TLIHAHEMHG NKWRELAKLF PGRTGKAVKN HWNGHMKRKL KSYLARGLPK QFQNLPVDPS  180
VSNRGWSTPK ETGENASMLD GQSSDSIRSV SEGKPMSSSP KGFGARSADA QPKVDAGDGQ  240
IDRVVSKFPV VTDNDMETVV SSSSVDLKVC VAAPSFVRST SEEKQMSYTG LSPAHSSQSR  300
YAHLDELSEL HQSDIADLLD MSYCESLMII PPDSPQSGNG GVPGM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-276216210110B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014756285.10.0PREDICTED: myb-related protein 3R-1-like isoform X6
TrEMBLA0A0Q3PY290.0A0A0Q3PY29_BRADI; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32730.23e-40Homeodomain-like protein